WU-BLAST 2.0 search of the National Center for Biotechnology Information's NR Protein Database.
BEAUTY post-processing provided by the Human Genome Sequencing Center, Baylor College of Medicine.
BEAUTY Reference:
Worley KC, Culpepper P, Wiese BA, Smith RF. BEAUTY-X: enhanced BLAST searches for DNA queries. Bioinformatics 1998;14(10):890-1. Abstract
Worley KC, Wiese BA, Smith RF. BEAUTY: an enhanced BLAST-based search tool that integrates multiple biological information resources into sequence similarity search results. Genome Res 1995 Sep;5(2):173-84 Abstract
RepeatMasker repeats found in sequence:No Repeats Found.Reference: Gish, Warren (1994-1997). unpublished. Gish, Warren and David J. States (1993). Identification of protein coding regions by database similarity search. Nat. Genet. 3:266-72.Notice: statistical significance is estimated under the assumption that the equivalent of one entire reading frame in the query sequence codes for protein and that significant alignments will involve only coding reading frames.
Query= A07C09_CONSENSUS (181 letters)
Translating both strands of query sequence in all 6 reading framesDatabase: nr 625,274 sequences; 197,782,623 total letters.Observed Numbers of Database Sequences Satisfying Various EXPECTation Thresholds (E parameter values) Histogram units: = 11 Sequences : less than 11 sequences EXPECTation Threshold (E parameter) | V Observed Counts--> 10000 3516 108 |========= 6310 3408 351 |=============================== 3980 3057 450 |======================================== 2510 2607 681 |============================================================= 1580 1926 550 |================================================== 1000 1376 422 |====================================== 631 954 340 |============================== 398 614 186 |================ 251 428 131 |=========== 158 297 88 |======== 100 209 62 |===== 63.1 147 59 |===== 39.8 88 26 |== 25.1 62 18 |= 15.8 44 8 |: >>>>>>>>>>>>>>>>>>>>> Expect = 10.0, Observed = 36 <<<<<<<<<<<<<<<<< 10.0 36 5 |: 6.31 31 5 |: 3.98 26 2 |: 2.51 24 1 |: 1.58 23 1 |: 1.00 22 0 | 0.63 22 0 | 0.40 22 1 |: 0.25 21 1 |: 0.16 20 1 |: 0.10 19 1 |: 0.063 18 0 | 0.040 18 0 | 0.025 18 0 | 0.016 18 1 |: 0.010 17 0 | 0.0063 17 0 | 0.0040 17 0 | 0.0025 17 0 | 0.0016 17 1 |: Smallest Sum Reading High Probability Sequences producing High-scoring Segment Pairs: Frame Score P(N) N gi|7384996|gb|AAF61634.1|(AF153422) lacZ [Cloning vec... -2 139 1.4e-08 1 gi|560554|gb|AAB31222.1|(S71728) truncated protein [S... -2 126 3.3e-07 1 gi|560556|gb|AAB31223.1|(S71730) influenza virus hema... -2 126 3.3e-07 1 gi|773414|gb|AAB05989.1|(U23751) beta galactosidase [... -2 126 3.3e-07 1 gi|9294786|gb|AAF86670.1|AF178449_1(AF178449) beta-ga... -2 126 3.3e-07 1 gi|11993889|gb|AAG42155.1|(AY012159) virion-associate... +2 122 1.4e-06 2 gi|4028979|emb|CAA06470.1|(AJ005323) glutamate permea... -2 126 2.9e-06 1 gi|7489187|pir||T02229protein BYJ15 - common tobacco ... +2 117 3.0e-06 1 gi|10281475|gb|AAG15510.1|U56995_1(U56995) mutant gre... +3 101 5.3e-06 2 gi|7489188|pir||T02232protein BYJ6 - common tobacco (... +2 113 7.9e-06 1 gi|762925|emb|CAA59990.1|(X85998) elastin like protei... +3 111 1.3e-05 1 gi|3402817|emb|CAA07704.1|(AJ007829) lacZ' [Cloning v... +3 101 0.00015 1 gi|9294789|gb|AAF86672.1|AF178450_1(AF178450) beta-ga... +3 101 0.00015 1 gi|560560|gb|AAB31225.1|(S71745) influenza virus hema... -1 97 0.00039 1 gi|560558|gb|AAB31224.1|(S71742) influenza virus hema... -1 96 0.00050 1 gi|1684629|emb|CAA70550.1|(Y09374) lacZ-PhoC [synthet... +3 101 0.00079 1 gi|4028981|emb|CAA06471.1|(AJ005324) glutamate permea... +3 101 0.0014 1 gi|2108238|gb|AAB63364.1|(U97360) HFLK homolog [Trepo... -2 67 0.016 2 gi|2231161|gb|AAB61958.1|(L81159) immunoglobulin mu [... +3 76 0.094 1 gi|10956629ref|NP_066765.1| virulence associated prot... +3 48 0.14 2 gi|3093383|emb|CAA06601.1|(AJ005572) hypothetical pro... +2 75 0.19 1 gi|7649667|emb|CAB88874.1|(AJ005810) phosphatidylinos... +3 80 0.26 1 gi|6523468|emb|CAB62404.1|(Y17270) UDP-N-acetylglucos... -3 48 0.68 2 gi|1083956|pir||JC4072virulence-associated 15-17K ant... +1 45 0.80 2 gi|1296517|emb|CAA63639.1|(X93090) NADPH--ferrihemopr... +2 47 0.95 2 gi|12643739|sp|Q27597|NCPR_DROMENADPH-CYTOCHROME P450... +2 47 0.95 2 gi|11281919|pir||T511032,3-dehydratase [validated] - ... +2 56 0.99 2 gi|7329192|gb|AAF59932.1|(AF237895) dTDP-4-keto-6-deo... +2 56 0.99 2 gi|3928682|gb|AAC79661.1|(AF068264) pyrroloquinoline ... +2 58 0.995 1 gi|4902498|emb|CAB43528.1|(Y14249) Gs protein, alpha ... -2 47 0.996 2 gi|11351313|pir||B83625probable gamma-glutamyltranspe... +3 49 0.997 2 gi|4966275|gb|AAD34651.1|AF039046_12(AF039046) R09B5.... -1 50 0.9992 2 gi|1684626|emb|CAA70548.1|(Y09373) lacZ-PhoC fusion [... +3 63 0.9997 1 gi|11344879|gb|AAG34521.1|(AF298784) enhanced green f... +2 63 0.9998 1 gi|6491882|gb|AAF14059.1|(AF045538) Mamu IgG-rh3 heav... -1 47 0.99991 2 gi|8394057ref|NP_058565.1| corin; Low Density Lipopro... -2 47 0.99992 3 Locally-aligned regions (HSPs) with respect to query sequence: Locus_ID Frame 3 Hits gi|10281475 | ______________________ gi|762925 | ___________________ gi|3402817 | ______________________ gi|9294789 | ______________________ gi|1684629 | ______________________ gi|4028981 | ______________________ gi|2231161 | ________________________ gi|10956629 | _________________ gi|7649667 | _______________ gi|1083956 | _________________ gi|11351313 | __________________ gi|1684626 | ____________ __________________________________________________ Query sequence: | | | | | 61 0 20 40 60 Locus_ID Frame 2 Hits gi|11993889 | ___________________ _____________ gi|7489187 | ___________________ gi|10281475 | ____________________ gi|7489188 | __________________ gi|3093383 | _____________________ gi|1296517 | ____________________________________ gi|12643739 | ____________________________________ gi|11281919 | ______ _______________ gi|7329192 | ______ _______________ gi|3928682 | __________________________ gi|11351313 | ___________ gi|11344879 | ____________ __________________________________________________ Query sequence: | | | | | 61 0 20 40 60 Locus_ID Frame 1 Hits gi|10956629 | _____________ gi|1083956 | _____________ __________________________________________________ Query sequence: | | | | | 61 0 20 40 60 Locus_ID Frame -1 Hits gi|560560 | ___________________________________ gi|560558 | ____________________ gi|4966275 | ___________________ _____________ gi|6491882 | __________________________________ __________________________________________________ Query sequence: | | | | | 61 0 20 40 60 Locus_ID Frame -2 Hits gi|7384996 | ___________________________________________ gi|560554 | ___________________ gi|560556 | ___________________ gi|773414 | ___________________ gi|9294786 | ___________________ gi|4028979 | ___________________ gi|2108238 | ________________ ___________ gi|4902498 |____________________ gi|6491882 | ________ gi|8394057 | ________________ ______ __________________________________________________ Query sequence: | | | | | 61 0 20 40 60 Locus_ID Frame -3 Hits gi|6523468 | ______________________________ _____ gi|4902498 | ______________ gi|8394057 | _________ __________________________________________________ Query sequence: | | | | | 61 0 20 40 60
Use the and icons to retrieve links to Entrez:
>gi|7384996|gb|AAF61634.1| (AF153422) lacZ [Cloning vector pTG8] Length = 197 Frame -2 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | | 197 0 50 100 150 Minus Strand HSPs: Score = 139 (48.9 bits), Expect = 1.4e-08, P = 1.4e-08 Identities = 29/53 (54%), Positives = 35/53 (66%), Frame = -2 Query: 174 PSSFIGTLKLGREERTMEPSL*T*RTPRQSLVPNSCSPGDPLVLERPPPRWSS 16 PS+ G L L + ++ P + T SL+ NSCSPGDPLVLERPPPRWSS Sbjct: 6 PSAQAGQLTLTKGNKSWVPGPPSRSTVSISLISNSCSPGDPLVLERPPPRWSS 58 >gi|560554|gb|AAB31222.1| (S71728) truncated protein [Saccharomyces cerevisiae] Length = 33 Frame -2 hits (HSPs): ____________________________________ __________________________________________________ Database sequence: | | | 33 0 20 Minus Strand HSPs: Score = 126 (44.4 bits), Expect = 3.3e-07, P = 3.3e-07 Identities = 22/24 (91%), Positives = 23/24 (95%), Frame = -2 Query: 87 SLVPNSCSPGDPLVLERPPPRWSS 16 SL+ NSCSPGDPLVLERPPPRWSS Sbjct: 7 SLISNSCSPGDPLVLERPPPRWSS 30 >gi|560556|gb|AAB31223.1| (S71730) influenza virus hemagglutinin 5' epitope tag=fusion protein {N-terminal, frame 1} [Saccharomyces cerevisiae=yeast, YCpIF15,16,17 cloning vector, Peptide Plasmid Synthetic Partial, 45 aa] Length = 45 Frame -2 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | 45 0 20 40 Minus Strand HSPs: Score = 126 (44.4 bits), Expect = 3.3e-07, P = 3.3e-07 Identities = 22/24 (91%), Positives = 23/24 (95%), Frame = -2 Query: 87 SLVPNSCSPGDPLVLERPPPRWSS 16 SL+ NSCSPGDPLVLERPPPRWSS Sbjct: 19 SLISNSCSPGDPLVLERPPPRWSS 42 >gi|773414|gb|AAB05989.1| (U23751) beta galactosidase [Cloning vector pBBR1MCS-2] >gi|833819|gb|AAB06689.1| (U25059) LacZ alpha peptide [Cloning vector pBBR1MCS-3] >gi|833823|gb|AAB06692.1| (U25060) LacZ alpha peptide [Cloning vector pBBR1MCS-4] >gi|833827|gb|AAB06695.1| (U25061) LacZ alpha peptide [Cloning vector pBBR1MCS-5] Length = 121 Frame -2 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 121 0 50 100 Minus Strand HSPs: Score = 126 (44.4 bits), Expect = 3.3e-07, P = 3.3e-07 Identities = 22/24 (91%), Positives = 23/24 (95%), Frame = -2 Query: 87 SLVPNSCSPGDPLVLERPPPRWSS 16 SL+ NSCSPGDPLVLERPPPRWSS Sbjct: 32 SLISNSCSPGDPLVLERPPPRWSS 55 >gi|9294786|gb|AAF86670.1|AF178449_1 (AF178449) beta-galactosidase alpha peptide [Integration vector pCD11PKS] >gi|9294795|gb|AAF86676.1|AF178452_1 (AF178452) beta-galactosidase alpha peptide [Integration vector pCD13PKS] Length = 127 Frame -2 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | 127 0 50 100 Minus Strand HSPs: Score = 126 (44.4 bits), Expect = 3.3e-07, P = 3.3e-07 Identities = 22/24 (91%), Positives = 23/24 (95%), Frame = -2 Query: 87 SLVPNSCSPGDPLVLERPPPRWSS 16 SL+ NSCSPGDPLVLERPPPRWSS Sbjct: 32 SLISNSCSPGDPLVLERPPPRWSS 55 >gi|11993889|gb|AAG42155.1| (AY012159) virion-associated nuclear-shuttling protein [Mus musculus] Length = 576 Frame 2 hits (HSPs): ___ __ __________________________________________________ Database sequence: | | | | | 576 0 150 300 450 Plus Strand HSPs: Score = 122 (42.9 bits), Expect = 1.4e-06, Sum P(2) = 1.4e-06 Identities = 23/23 (100%), Positives = 23/23 (100%), Frame = +2 Query: 17 ELHRGGGRSRTSGSPGLQEFGTR 85 ELHRGGGRSRTSGSPGLQEFGTR Sbjct: 6 ELHRGGGRSRTSGSPGLQEFGTR 28 Score = 30 (10.6 bits), Expect = 1.4e-06, Sum P(2) = 1.4e-06 Identities = 6/14 (42%), Positives = 7/14 (50%), Frame = +2 Query: 104 HVYNDGSIVRSSRP 145 H Y D S +R P Sbjct: 505 HAYKDWSQIRYPPP 518 >gi|4028979|emb|CAA06470.1| (AJ005323) glutamate permease [synthetic construct] >gi|4028985|emb|CAA06473.1| (AJ005326) glutamate permease [synthetic construct] >gi|4028991|emb|CAA06476.1| (AJ005329) glutamate permease [synthetic construct] Length = 459 Frame -2 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | | 459 0 150 300 450 Minus Strand HSPs: Score = 126 (44.4 bits), Expect = 2.9e-06, P = 2.9e-06 Identities = 22/24 (91%), Positives = 23/24 (95%), Frame = -2 Query: 87 SLVPNSCSPGDPLVLERPPPRWSS 16 SL+ NSCSPGDPLVLERPPPRWSS Sbjct: 205 SLISNSCSPGDPLVLERPPPRWSS 228 >gi|7489187|pir||T02229 protein BYJ15 - common tobacco (fragment) >gi|2280518|dbj|BAA21615.1| (AB005878) BYJ15 [Nicotiana tabacum] Length = 172 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 172 0 50 100 150 Plus Strand HSPs: Score = 117 (41.2 bits), Expect = 3.0e-06, P = 3.0e-06 Identities = 22/22 (100%), Positives = 22/22 (100%), Frame = +2 Query: 17 ELHRGGGRSRTSGSPGLQEFGT 82 ELHRGGGRSRTSGSPGLQEFGT Sbjct: 2 ELHRGGGRSRTSGSPGLQEFGT 23 >gi|10281475|gb|AAG15510.1|U56995_1 (U56995) mutant green fluorescent protein [Cloning vector pGreenscript A] Length = 302 Frame 3 hits (HSPs): _____ Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | || 302 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 101 (35.6 bits), Expect = 5.3e-06, Sum P(2) = 5.3e-06 Identities = 20/26 (76%), Positives = 22/26 (84%), Frame = +3 Query: 18 SSTAVAAALELVDPPGCRNSAREIVV 95 SSTAVAAALELVDPPGCRNS + + Sbjct: 20 SSTAVAAALELVDPPGCRNSISSLSI 45 Score = 38 (13.4 bits), Expect = 5.3e-06, Sum P(2) = 5.3e-06 Identities = 8/24 (33%), Positives = 11/24 (45%), Frame = +2 Query: 98 VLHVYNDGSIVRSSRPSFNVPIND 169 + H DGS+ + N PI D Sbjct: 231 IRHNIKDGSVQLADHYQQNTPIGD 254 >gi|7489188|pir||T02232 protein BYJ6 - common tobacco (fragment) >gi|2280520|dbj|BAA21616.1| (AB005879) BYJ6 [Nicotiana tabacum] Length = 177 Frame 2 hits (HSPs): ______ __________________________________________________ Database sequence: | | | | | 177 0 50 100 150 Plus Strand HSPs: Score = 113 (39.8 bits), Expect = 7.9e-06, P = 7.9e-06 Identities = 21/21 (100%), Positives = 21/21 (100%), Frame = +2 Query: 23 HRGGGRSRTSGSPGLQEFGTR 85 HRGGGRSRTSGSPGLQEFGTR Sbjct: 5 HRGGGRSRTSGSPGLQEFGTR 25 >gi|762925|emb|CAA59990.1| (X85998) elastin like protein [Drosophila melanogaster] Length = 110 Frame 3 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | | | | 110 0 20 40 60 80 100 Plus Strand HSPs: Score = 111 (39.1 bits), Expect = 1.3e-05, P = 1.3e-05 Identities = 22/23 (95%), Positives = 23/23 (100%), Frame = +3 Query: 18 SSTAVAAALELVDPPGCRNSARE 86 SSTAVAAALELVDPPGCRNSAR+ Sbjct: 2 SSTAVAAALELVDPPGCRNSARD 24 >gi|3402817|emb|CAA07704.1| (AJ007829) lacZ' [Cloning vector pGreen] Length = 120 Frame 3 hits (HSPs): ____________ __________________________________________________ Database sequence: | | | | 120 0 50 100 Plus Strand HSPs: Score = 101 (35.6 bits), Expect = 0.00015, P = 0.00015 Identities = 20/26 (76%), Positives = 22/26 (84%), Frame = +3 Query: 18 SSTAVAAALELVDPPGCRNSAREIVV 95 SSTAVAAALELVDPPGCRNS + + Sbjct: 20 SSTAVAAALELVDPPGCRNSISSLSI 45 >gi|9294789|gb|AAF86672.1|AF178450_1 (AF178450) beta-galactosidase alpha peptide [Integration vector pCD11PSK] >gi|9294798|gb|AAF86678.1|AF178453_1 (AF178453) beta-galactosidase alpha peptide [Integration vector pCD13PSK] Length = 127 Frame 3 hits (HSPs): ___________ __________________________________________________ Database sequence: | | | | 127 0 50 100 Plus Strand HSPs: Score = 101 (35.6 bits), Expect = 0.00015, P = 0.00015 Identities = 20/26 (76%), Positives = 22/26 (84%), Frame = +3 Query: 18 SSTAVAAALELVDPPGCRNSAREIVV 95 SSTAVAAALELVDPPGCRNS + + Sbjct: 20 SSTAVAAALELVDPPGCRNSISSLSI 45 >gi|560560|gb|AAB31225.1| (S71745) influenza virus hemagglutinin 5' epitope tag=fusion protein {N-terminal, frame 3} [Saccharomyces cerevisiae=yeast, YCpIF15,16,17 cloning vector, Peptide Plasmid Synthetic Partial, 56 aa] Length = 56 Frame -1 hits (HSPs): __________________________________________ __________________________________________________ Database sequence: | | | | 56 0 20 40 Minus Strand HSPs: Score = 97 (34.1 bits), Expect = 0.00039, P = 0.00039 Identities = 26/46 (56%), Positives = 29/46 (63%), Frame = -1 Query: 130 YYGTVVIDMKNATTISRA-----EFLQPGGSTSSRAAATAVELLXA 8 Y + V + A I R+ EFLQPGGSTSSRAAATAVEL A Sbjct: 11 YASSTVSGIPRAAGIHRSDKLDIEFLQPGGSTSSRAAATAVELQFA 56 >gi|560558|gb|AAB31224.1| (S71742) influenza virus hemagglutinin 5' epitope tag=fusion protein {N-terminal} [Saccharomyces cerevisiae=yeast, YCpIF15,16,17 cloning vector, Peptide Plasmid Synthetic Partial, 50 aa] Length = 50 Frame -1 hits (HSPs): _______________________ __________________________________________________ Database sequence: | | | | 50 0 20 40 Minus Strand HSPs: Score = 96 (33.8 bits), Expect = 0.00050, P = 0.00050 Identities = 21/23 (91%), Positives = 21/23 (91%), Frame = -1 Query: 76 EFLQPGGSTSSRAAATAVELLXA 8 EFLQPGGSTSSRAAATAVEL A Sbjct: 28 EFLQPGGSTSSRAAATAVELQFA 50 >gi|1684629|emb|CAA70550.1| (Y09374) lacZ-PhoC [synthetic construct] Length = 316 Frame 3 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | | | 316 0 50 100 150 200 250 300 Plus Strand HSPs: Score = 101 (35.6 bits), Expect = 0.00079, P = 0.00079 Identities = 20/26 (76%), Positives = 22/26 (84%), Frame = +3 Query: 18 SSTAVAAALELVDPPGCRNSAREIVV 95 SSTAVAAALELVDPPGCRNS + + Sbjct: 20 SSTAVAAALELVDPPGCRNSISSLSI 45 >gi|4028981|emb|CAA06471.1| (AJ005324) glutamate permease [synthetic construct] >gi|4028987|emb|CAA06474.1| (AJ005327) glutamate permease [synthetic construct] >gi|4028993|emb|CAA06477.1| (AJ005330) glutamate permease [synthetic construct] Length = 459 Frame 3 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | 459 0 150 300 450 Plus Strand HSPs: Score = 101 (35.6 bits), Expect = 0.0014, P = 0.0014 Identities = 20/26 (76%), Positives = 22/26 (84%), Frame = +3 Query: 18 SSTAVAAALELVDPPGCRNSAREIVV 95 SSTAVAAALELVDPPGCRNS + + Sbjct: 193 SSTAVAAALELVDPPGCRNSISSLSI 218 >gi|2108238|gb|AAB63364.1| (U97360) HFLK homolog [Treponema pallidum] Length = 220 Frame -2 hits (HSPs): ___ _____ __________________________________________________ Database sequence: | | | | | | 220 0 50 100 150 200 Minus Strand HSPs: Score = 67 (23.6 bits), Expect = 0.016, Sum P(2) = 0.016 Identities = 13/19 (68%), Positives = 14/19 (73%), Frame = -2 Query: 84 LVPNSCSPGDPLVLERPPP 28 L +SC PG PLVLERP P Sbjct: 195 LQKDSCRPGGPLVLERPHP 213 Score = 36 (12.7 bits), Expect = 0.016, Sum P(2) = 0.016 Identities = 6/13 (46%), Positives = 9/13 (69%), Frame = -2 Query: 150 KLGREERTMEPSL 112 + G+ RT+EP L Sbjct: 46 RFGKYHRTLEPGL 58 >gi|2231161|gb|AAB61958.1| (L81159) immunoglobulin mu [Equus caballus] Length = 154 Frame 3 hits (HSPs): __________ __________________________________________________ Database sequence: | | | | | 154 0 50 100 150 Plus Strand HSPs: Score = 76 (26.8 bits), Expect = 0.098, P = 0.094 Identities = 17/31 (54%), Positives = 21/31 (67%), Frame = +3 Query: 51 VDPPGCRNSAREIV--VAFFMSITTVP*YVL 137 VDPPGCRNSARE + + FF+ + P VL Sbjct: 1 VDPPGCRNSARENMNHLWFFLFLVAAPRCVL 31 >gi|10956629 ref|NP_066765.1| virulence associated protein VapA [Rhodococcus equi] >gi|10657877|gb|AAG21716.1| (AF116907) virulence associated protein VapA [Rhodococcus equi] Length = 189 Frame 3 hits (HSPs): _____ Frame 1 hits (HSPs): _____ __________________________________________________ Database sequence: | | | | | 189 0 50 100 150 Plus Strand HSPs: Score = 48 (16.9 bits), Expect = 0.15, Sum P(2) = 0.14 Identities = 10/20 (50%), Positives = 15/20 (75%), Frame = +3 Query: 18 SSTAVAAALELVDPPGCRNS 77 ++TAVAAA ++ P GC N+ Sbjct: 13 AATAVAAAAAMI-PAGCANA 31 Score = 45 (15.8 bits), Expect = 0.15, Sum P(2) = 0.14 Identities = 9/15 (60%), Positives = 10/15 (66%), Frame = +1 Query: 121 FHSTFFTSKLQRTYK 165 F T FT+ LQR YK Sbjct: 125 FWGTLFTNDLQRLYK 139 >gi|3093383|emb|CAA06601.1| (AJ005572) hypothetical protein [Plasmodium falciparum] Length = 186 Frame 2 hits (HSPs): _______ __________________________________________________ Database sequence: | | | | | 186 0 50 100 150 Plus Strand HSPs: Score = 75 (26.4 bits), Expect = 0.21, P = 0.19 Identities = 16/25 (64%), Positives = 18/25 (72%), Frame = +2 Query: 44 RTSGSPGLQEFGTRDCRGVLHVYND 118 RTSGSPGLQEF T CR + H N+ Sbjct: 1 RTSGSPGLQEFCTSSCR-IRHEENN 24 >gi|7649667|emb|CAB88874.1| (AJ005810) phosphatidylinositol 4-kinase [Solanum tuberosum] Length = 517 Frame 3 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | 517 0 150 300 450 Plus Strand HSPs: Score = 80 (28.2 bits), Expect = 0.30, P = 0.26 Identities = 17/18 (94%), Positives = 17/18 (94%), Frame = +3 Query: 33 AAALELVDPPGCRNSARE 86 AAALELVDPPGCRNS RE Sbjct: 1 AAALELVDPPGCRNS-RE 17 >gi|6523468|emb|CAB62404.1| (Y17270) UDP-N-acetylglucosamin 1-carboxyvinyltransferase [Streptomyces viridochromogenes] Length = 140 Frame -3 hits (HSPs): ______________ __________________________________________________ Database sequence: | | | | 140 0 50 100 Minus Strand HSPs: Score = 48 (16.9 bits), Expect = 1.1, Sum P(2) = 0.68 Identities = 14/37 (37%), Positives = 18/37 (48%), Frame = -3 Query: 122 NRRYRHEERHDNLSCRIPAARGIH*F*SGR-HRGGAP 15 +RR +ER + R+ A G H R HRGG P Sbjct: 15 HRREDEQERVRGAAVRLTAQPGAHGAAPRRSHRGGVP 51 Score = 32 (11.3 bits), Expect = 1.1, Sum P(2) = 0.68 Identities = 5/5 (100%), Positives = 5/5 (100%), Frame = -3 Query: 179 RCHRR 165 RCHRR Sbjct: 13 RCHRR 17 >gi|1083956|pir||JC4072 virulence-associated 15-17K antigen precursor - Rhodococcus equi >gi|456378|gb|AAC43307.1| (U05250) 17-kDa virulence associated protein [Corynebacterium hoagii] >gi|496381|dbj|BAA04768.1| (D21236) virulence-associated 15-17-kDa antigens [Rhodococcus equi] >gi|10801067|dbj|BAB16621.1| (AP001204) virulence-associated 15-17kDa antigen (R. equi VapA protein) [Corynebacterium hoagii] Length = 189 Frame 3 hits (HSPs): _____ Frame 1 hits (HSPs): _____ Annotated Domains: ______ __________________________________________________ Database sequence: | | | | | 189 0 50 100 150 __________________ Annotated Domains: Entrez domain: signal sequence 1..21 PROSITE AA_TRANSFER_CLASS_2: Aminotransferases c 7..16 __________________ Plus Strand HSPs: Score = 45 (15.8 bits), Expect = 1.6, Sum P(2) = 0.80 Identities = 9/15 (60%), Positives = 10/15 (66%), Frame = +1 Query: 121 FHSTFFTSKLQRTYK 165 F T FT+ LQR YK Sbjct: 125 FWGTLFTNDLQRLYK 139 Score = 38 (13.4 bits), Expect = 1.6, Sum P(2) = 0.80 Identities = 9/20 (45%), Positives = 14/20 (70%), Frame = +3 Query: 18 SSTAVAAALELVDPPGCRNS 77 ++TAVAAA ++ P G N+ Sbjct: 13 AATAVAAAAAMI-PAGVANA 31 >gi|1296517|emb|CAA63639.1| (X93090) NADPH--ferrihemoprotein reductase [Drosophila melanogaster] Length = 679 Frame 2 hits (HSPs): __ ____ __________________________________________________ Database sequence: | | | | | | 679 0 150 300 450 600 Plus Strand HSPs: Score = 47 (16.5 bits), Expect = 3.1, Sum P(2) = 0.95 Identities = 14/37 (37%), Positives = 24/37 (64%), Frame = +2 Query: 38 RSRTSGSP-GLQEFGT--RD-CRGVLHVYNDGSIVRSSRP 145 RS S SP G +++ + +D CR ++H+ D ++S RP Sbjct: 407 RSMASISPEGKEKYQSWIQDACRNIVHILED---IKSCRP 443 Score = 46 (16.2 bits), Expect = 3.1, Sum P(2) = 0.95 Identities = 8/9 (88%), Positives = 9/9 (100%), Frame = +2 Query: 17 ELHRGGGRS 43 ELH+GGGRS Sbjct: 295 ELHKGGGRS 303 >gi|12643739|sp|Q27597|NCPR_DROME NADPH-CYTOCHROME P450 REDUCTASE (CPR) (P450R) >gi|7297099|gb|AAF52367.1| (AE003613) Cpr gene product [Drosophila melanogaster] Length = 679 Frame 2 hits (HSPs): __ ____ __________________________________________________ Database sequence: | | | | | | 679 0 150 300 450 600 Plus Strand HSPs: Score = 47 (16.5 bits), Expect = 3.1, Sum P(2) = 0.95 Identities = 14/37 (37%), Positives = 24/37 (64%), Frame = +2 Query: 38 RSRTSGSP-GLQEFGT--RD-CRGVLHVYNDGSIVRSSRP 145 RS S SP G +++ + +D CR ++H+ D ++S RP Sbjct: 407 RSMASISPEGKEKYQSWIQDACRNIVHILED---IKSCRP 443 Score = 46 (16.2 bits), Expect = 3.1, Sum P(2) = 0.95 Identities = 8/9 (88%), Positives = 9/9 (100%), Frame = +2 Query: 17 ELHRGGGRS 43 ELH+GGGRS Sbjct: 295 ELHKGGGRS 303 >gi|11281919|pir||T51103 2,3-dehydratase [validated] - Streptomyces antibioticus (ATCC 11891) >gi|5902167|gb|AAD55451.1| (AF055579) 2,3-dehydratase [Streptomyces antibioticus] Length = 474 Frame 2 hits (HSPs): _ ___ __________________________________________________ Database sequence: | | | | | 474 0 150 300 450 Plus Strand HSPs: Score = 56 (19.7 bits), Expect = 4.3, Sum P(2) = 0.99 Identities = 12/17 (70%), Positives = 12/17 (70%), Frame = +2 Query: 59 PGLQEFGTRDCRGVLHV 109 PGL F TR RGVLHV Sbjct: 338 PGLAAFVTRRIRGVLHV 354 Score = 32 (11.3 bits), Expect = 4.3, Sum P(2) = 0.99 Identities = 5/6 (83%), Positives = 6/6 (100%), Frame = +2 Query: 20 LHRGGG 37 +HRGGG Sbjct: 144 VHRGGG 149 >gi|7329192|gb|AAF59932.1| (AF237895) dTDP-4-keto-6-deoxyglucose 2,3-dehydratase [Streptomyces antibioticus] Length = 474 Frame 2 hits (HSPs): _ ___ __________________________________________________ Database sequence: | | | | | 474 0 150 300 450 Plus Strand HSPs: Score = 56 (19.7 bits), Expect = 4.3, Sum P(2) = 0.99 Identities = 12/17 (70%), Positives = 12/17 (70%), Frame = +2 Query: 59 PGLQEFGTRDCRGVLHV 109 PGL F TR RGVLHV Sbjct: 338 PGLAAFVTRRIRGVLHV 354 Score = 32 (11.3 bits), Expect = 4.3, Sum P(2) = 0.99 Identities = 5/6 (83%), Positives = 6/6 (100%), Frame = +2 Query: 20 LHRGGG 37 +HRGGG Sbjct: 144 VHRGGG 149 >gi|3928682|gb|AAC79661.1| (AF068264) pyrroloquinoline quinone synthesis B [Pseudomonas aeruginosa] Length = 52 Frame 2 hits (HSPs): __________________________ __________________________________________________ Database sequence: | | | | 52 0 20 40 Plus Strand HSPs: Score = 58 (20.4 bits), Expect = 5.3, P = 1.0 Identities = 12/31 (38%), Positives = 18/31 (58%), Frame = +2 Query: 83 RDCRGVLHVYNDGSIVRSSRPSFNVPINDDG 175 R+CRGV DGS+ R ++ ++DDG Sbjct: 22 RNCRGV----RDGSVAAQPRTQSSIALSDDG 48 >gi|4902498|emb|CAB43528.1| (Y14249) Gs protein, alpha subunit [Geodia cydonium] Length = 381 Frame -2 hits (HSPs): ____ Frame -3 hits (HSPs): ___ __________________________________________________ Database sequence: | | | | 381 0 150 300 Minus Strand HSPs: Score = 47 (16.5 bits), Expect = 5.6, Sum P(2) = 1.0 Identities = 12/24 (50%), Positives = 13/24 (54%), Frame = -2 Query: 75 NSCSPGDPLVLERPPPRWSSXXLK 4 NS P D L L + PP SS LK Sbjct: 300 NSYRPPDNLDLSKEPPGSSSTFLK 323 Score = 38 (13.4 bits), Expect = 5.6, Sum P(2) = 1.0 Identities = 7/16 (43%), Positives = 11/16 (68%), Frame = -3 Query: 158 VR*SLDVKNVLWNRRY 111 +R SLD+ +WN R+ Sbjct: 251 LRESLDLFEQIWNNRW 266 >gi|11351313|pir||B83625 probable gamma-glutamyltranspeptidase PA0164 [imported] - Pseudomonas aeruginosa (strain PAO1) >gi|9945996|gb|AAG03554.1|AE004454_6 (AE004454) probable gamma-glutamyltranspeptidase [Pseudomonas aeruginosa] Length = 538 Frame 3 hits (HSPs): __ Frame 2 hits (HSPs): __ __________________________________________________ Database sequence: | | | | | 538 0 150 300 450 Plus Strand HSPs: Score = 49 (17.2 bits), Expect = 5.9, Sum P(2) = 1.0 Identities = 10/20 (50%), Positives = 14/20 (70%), Frame = +3 Query: 9 AXRSSTAVAAALELVDPPGC 68 A ++ A AAAL +V+P GC Sbjct: 46 AIDAAIATAAALTVVEPTGC 65 Score = 39 (13.7 bits), Expect = 5.9, Sum P(2) = 1.0 Identities = 7/12 (58%), Positives = 7/12 (58%), Frame = +2 Query: 71 EFGTRDCRGVLH 106 EFG RDC H Sbjct: 286 EFGERDCARTWH 297 >gi|4966275|gb|AAD34651.1|AF039046_12 (AF039046) R09B5.12 gene product [Caenorhabditis elegans] Length = 388 Frame -1 hits (HSPs): ___ ____ __________________________________________________ Database sequence: | | | | 388 0 150 300 Minus Strand HSPs: Score = 50 (17.6 bits), Expect = 7.2, Sum P(2) = 1.0 Identities = 10/22 (45%), Positives = 16/22 (72%), Frame = -1 Query: 130 YYGTVVIDMKNATTISRAEFLQ 65 +YG + +++K ATTI+ FLQ Sbjct: 301 FYG-IELNLKGATTITAKRFLQ 321 Score = 34 (12.0 bits), Expect = 7.2, Sum P(2) = 1.0 Identities = 4/14 (28%), Positives = 9/14 (64%), Frame = -1 Query: 181 NGAIVVYRYVEAWT 140 +G + Y +++ WT Sbjct: 252 SGLVAAYYHLQLWT 265 >gi|1684626|emb|CAA70548.1| (Y09373) lacZ-PhoC fusion [synthetic construct] Length = 262 Frame 3 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | | 262 0 50 100 150 200 250 Plus Strand HSPs: Score = 63 (22.2 bits), Expect = 8.3, P = 1.0 Identities = 14/14 (100%), Positives = 14/14 (100%), Frame = +3 Query: 18 SSTAVAAALELVDP 59 SSTAVAAALELVDP Sbjct: 20 SSTAVAAALELVDP 33 >gi|11344879|gb|AAG34521.1| (AF298784) enhanced green fluorescent protein 3 [N-terminal GFP fusion vector pUG34] >gi|11344904|gb|AAG34539.1| (AF298791) enhanced green fluorescent protein 3 [N-terminal GFP fusion vector pUG36] Length = 264 Frame 2 hits (HSPs): ____ __________________________________________________ Database sequence: | | | | | | | 264 0 50 100 150 200 250 Plus Strand HSPs: Score = 63 (22.2 bits), Expect = 8.4, P = 1.0 Identities = 12/13 (92%), Positives = 13/13 (100%), Frame = +2 Query: 38 RSRTSGSPGLQEF 76 +SRTSGSPGLQEF Sbjct: 238 KSRTSGSPGLQEF 250 >gi|6491882|gb|AAF14059.1| (AF045538) Mamu IgG-rh3 heavy chain [Macaca mulatta] Length = 353 Frame -1 hits (HSPs): _______ Frame -2 hits (HSPs): __ __________________________________________________ Database sequence: | | | | 353 0 150 300 Minus Strand HSPs: Score = 47 (16.5 bits), Expect = 9.3, Sum P(2) = 1.0 Identities = 15/42 (35%), Positives = 18/42 (42%), Frame = -1 Query: 136 RTYYGTVVIDMKNATTISRAEFLQPGGSTSSRAA-ATAVELL 14 +TY VV + N R EF P G T+ A ELL Sbjct: 84 QTYVCNVVHEPSNTKVDKRVEFTPPCGDTTPPCPPCPAPELL 125 Score = 35 (12.3 bits), Expect = 9.3, Sum P(2) = 1.0 Identities = 7/9 (77%), Positives = 8/9 (88%), Frame = -2 Query: 180 TVPSSFIGT 154 TVPSS +GT Sbjct: 75 TVPSSSLGT 83 >gi|8394057 ref|NP_058565.1| corin; Low Density Lipoprotein Receptor Related Protein 4 [Mus musculus] >gi|7513714|pir||JE0315 low-density lipoprotein receptor-related protein - mouse >gi|3869145|dbj|BAA34371.1| (AB013874) Low Density Lipoprotein Receptor Related Protein 4 [Mus musculus] Length = 1113 Frame -2 hits (HSPs): __ __ Frame -3 hits (HSPs): _ __________________________________________________ Database sequence: | | | | | | | | | 1113 0 150 300 450 600 750 900 1050 Minus Strand HSPs: Score = 47 (16.5 bits), Expect = 9.5, Sum P(3) = 1.0 Identities = 10/21 (47%), Positives = 13/21 (61%), Frame = -2 Query: 75 NSC--SPGDPLVLERPPPRWS 19 +SC G PLV ERP +W+ Sbjct: 1046 DSCMGDSGGPLVCERPGGQWT 1066 Score = 33 (11.6 bits), Expect = 9.5, Sum P(3) = 1.0 Identities = 6/7 (85%), Positives = 7/7 (100%), Frame = -2 Query: 168 SFIGTLK 148 SF+GTLK Sbjct: 134 SFVGTLK 140 Score = 30 (10.6 bits), Expect = 9.5, Sum P(3) = 1.0 Identities = 5/10 (50%), Positives = 7/10 (70%), Frame = -3 Query: 104 EERHDNLSCR 75 ++RH L CR Sbjct: 271 DDRHGLLPCR 280 Parameters: filter=none matrix=BLOSUM62 V=50 B=50 E=10 gi H=1 sort_by_pvalue echofilter ctxfactor=5.93 Query ----- As Used ----- ----- Computed ---- Frame MatID Matrix name Lambda K H Lambda K H Std. 0 BLOSUM62 0.318 0.135 0.401 +3 0 BLOSUM62 0.318 0.135 0.401 0.343 0.142 0.430 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +2 0 BLOSUM62 0.318 0.135 0.401 0.328 0.147 0.463 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a +1 0 BLOSUM62 0.318 0.135 0.401 0.362 0.158 0.696 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -1 0 BLOSUM62 0.318 0.135 0.401 0.325 0.134 0.386 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -2 0 BLOSUM62 0.318 0.135 0.401 0.331 0.145 0.474 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a -3 0 BLOSUM62 0.318 0.135 0.401 0.371 0.168 0.701 Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a Query Frame MatID Length Eff.Length E S W T X E2 S2 +3 0 59 58 10. 58 3 12 22 0.093 30 26 0.089 30 +2 0 60 59 10. 58 3 12 22 0.095 30 26 0.094 30 +1 0 60 58 10. 58 3 12 22 0.093 30 26 0.089 30 -1 0 60 59 10. 58 3 12 22 0.095 30 26 0.094 30 -2 0 60 58 10. 58 3 12 22 0.093 30 26 0.089 30 -3 0 59 58 10. 58 3 12 22 0.093 30 26 0.089 30 Statistics: Database: /usr/local/dot5/sl_home/beauty/seqdb/blast/nr Title: nr Release date: unknown Posted date: 4:06 PM CST Feb 28, 2001 Format: BLAST # of letters in database: 197,782,623 # of sequences in database: 625,274 # of database sequences satisfying E: 36 No. of states in DFA: 571 (56 KB) Total size of DFA: 107 KB (128 KB) Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00 No. of threads or processors used: 6 Search cpu time: 67.63u 1.11s 68.74t Elapsed: 00:00:12 Total cpu time: 67.66u 1.15s 68.81t Elapsed: 00:00:12 Start: Mon Oct 1 20:42:01 2001 End: Mon Oct 1 20:42:13 2001
Annotated Domains Database: March 14, 2000
Release Date: March 14, 2000